University | Singapore University of Social Science (SUSS) |
Subject | BME355 Genomic Sequence Analysis Assignment |
BME355 Genomic Sequence Analysis Assignment, SUSS, Singapore: Using the OMIM database information for Type 2 Diabetes Mellitus (T2D)
Question 1
Using the OMIM database information for Type 2 Diabetes Mellitus (T2D)
(https://omim.org/entry/125853), solve the following tasks.
Question 1a
Extract out the genes associated with T2D and use the list as input in the online tool DAVID (Database for Annotation, Visualization, and Integrated Discovery).
Question 1b
Create a functional annotation clustering of the gene list and paste screenshots of the results from GOTERM_BP/CC/MF_DIRECT and KEGG_PATHWAY. Report the clusters having enrichment scores above 1.
Question 1c
Appraise the results obtained and discuss the relevancy of the findings to the gene list.
Question 2
Using the NCBI database, explore the gene with Gene ID: 79923.
Question 2a
State the gene symbol given to this ID and the full official name of the gene.
Question 2b
Discuss the function of this gene in your own words.
Question 2c
Determine the mRNA transcripts and protein isoforms of this gene.
Question 2d
Describe FIVE (5) pathways in which the corresponding gene is involved in.
Question 2e
Identify the conserved domains in the protein isoforms of this gene.
Hire a Professional Essay & Assignment Writer for completing your Academic Assessments
Question 3
Demonstrate your understanding of molecular genetics and computational biology by critically evaluating the following statements.
Question 3a
Protein alignments are often more informative than DNA alignments.
Question 3b
When comparing two sequences, it is necessary to repeat the search using different scoring matrices.
Question 3c
The statistical significance of a BLAST result can be assessed through S-values.
Question 3d
Position-specific iterated BLAST (PSI-Blast) is often less sensitive than a regular Blast search in finding distantly related protein sequences.
Question 3e
Benchmarking is an important approach to compare different software and determine their accuracy.
Question 4
With the help of an alignment tool you have learned, examine the human sequence given below, and furnish answers to the following questions:
>SEQ
MCGATSFLHECTRLILVTTQNAEFLQKGLQVHTCFGVYPHASVWHDCASQK
KGCAVYLHVSVEFNKLIPE
NGFIKFHQVRRVMTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTH
GTLESVNGPKAGSRGLTS
LADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLE
EYKNYLDAANMSMRVRR
HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQ
YFYETKCNPMGYTKEGCRG
IDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Question 4a
Give the name and accession number of the sequence.
Question 4b
Appraise the function of the corresponding gene.
Question 4c
Describe FIVE (5) pathways which the genic form is involved in.
Question 4d
List the Gene Ontology functions and processes.
Question 5
Using the resulting information from the above-mentioned sequence in
Question 4,
extract out the sequences from Homo sapiens and organisms such as Pan troglodytes, Canis lupus familiaris, Bos Taurus, and Mus musculus
Question 5a
Paste the sequences in a fast format.
Question 5b
Create a multiple sequence alignment using any multiple sequence alignment tool. Paste the alignment and the phylogenetic tree.
Question 5c
Evaluate the alignment and the phylogenetic tree derived in Question 5b.
Buy Custom Answer of This Assessment & Raise Your Grades
Are you a student at the Singapore University of Social Science (SUSS) struggling with your BME355 Genomic Sequence Analysis Assignment on Type 2 Diabetes Mellitus (T2D)? Look no further! At Assignment Helper SG, we offer a top-notch Report Writing Service for Singapore students. Our experts are here to assist you with your individual assignments, ensuring you excel in your coursework. Don't stress over your assignment; pay our experts for the help you need and achieve academic success.
- BUS341 Business Negotiation: An International Perspective Case Study, MU, Singapore: What went wrong ( from an intercultural communication perspective )
- SOC263 Sociology of Education, SUSS, Singapore: There is no power relation without the correlative constitution of a field of knowledge, nor any knowledge
- English Essay, NTU, Singapore: Meritocracy has been upheld as a significant tenet of Singapore society. However, many critics argue
- Mechanical Engineering & Technology (topic strength of materials) Other, NTU, Singapore: A simply supported beam of a square cross-section of side 100mm with a uniform distributed
- Ports And Terminals Management Assignment, SUSS, Singapore: Perform A Study On The Effect/Impact Of Oil Price On The Demand For Offshore Support Vessels (PSV/AHTSV) And/Or Mobile Offshore Drilling Units
- Mobile system and security Other, KU, Singapore: AMY Networks is a consultancy business that designs, installs, and operates different types of wireless and wired networks
- FIN2001S Economics and Market Innovations Assignment, UCD, Singapore: Discuss how can the mentioned multisided company use technology effectively to enhance business performance
- MGMT415 Airline Management Assignment, SUSS, Singapore: Turkish Airlines Define Revenue Drivers, Cost Structures, The Importance Of Ancillary (Non-Flying) Revenues, The General Level Of Annual Profitability
- School of Diploma – PHRM: Individual Assignment Assignment, NYP, Singapore: DNR Wheels Pte Ltd is a leading provider of disability and rehabilitative equipment including
- BM1987 Employment law Assignment, NYP, Singapore: The ability to provide a clear and accurate summary of background, scope and coverage of the Employment
UP TO 15 % DISCOUNT